Default language
English
GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Menu
0 items
Cartridge belt
Cartridge beltCartridge belt
Cartridge belt
£10.99 inc. tax
£9.16 ex. tax
? Tax based on United Kingdom.
Jack Pyke cartridge belt in green or camo
  • Holds 26 - 20 or 12 bore
  • Fully adjustable waist strap with quick release buckle
£10.99 inc. tax
£9.16 ex. tax
? Tax based on United Kingdom.
Add to Cart
Product Code: jpcb
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Details
Related Products
Leather bullet wallet
Gun care/ accessories
Leather bullet wallet
£21.50
Add To Cart
A high quality oak-tanned leather bullet wallet with elasticated retainers to hold ten rounds of ammunition....
cartridge pouch
Other Bags
cartridge pouch
£23.15
Add To Cart
Designed to attach to any belt, the deep purse shaped pouch can easily hold 125 12g shells and the smaller...
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i