Default language
English
GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Menu
0 items
Notify me when product is back in stock
Open Top Dummy Bag
Open Top Dummy Bag
RRP £29.99
£24.95 inc. tax
£20.79 ex. tax
? Tax based on United Kingdom.

Open Top Dummy Bag

  • Designed by Sporting Saint to aid with carrying dummies and other items. Also ideal for game picking up
  • The Dummy Bag is Open Top so no flap getting in the way!
  • Size 49cm across by 32cm deep
  • Removable washable liner
  • Large net outer pocket
  • Adjustable shoulder strap
  • Will carry 6 - 10 1lb Dummies
£24.95 inc. tax
£20.79 ex. tax
? Tax based on United Kingdom.
Add to Cart
Product Code: otdb
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Details
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i