Default language
English
GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Menu
0 items
Country classic slip lead
Country classic slip lead
£5.50 inc. tax
£4.58 ex. tax
? Tax based on United Kingdom.
  • Rubber fittings
  • looped handle
  • rubber stop
  • Olive green, black
  • 8mm braided slip lead
  • Standard 1.5m in length
  • Designed and made by sporting saint
£5.50 inc. tax
£4.58 ex. tax
? Tax based on United Kingdom.
Add to Cart
Product Code: L-05
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Details
Related Products
Heeling lead
leads and tethers
Heeling lead
£6.95
Add To Cart
Heeling Lead With an 'Easy Grip' large toggle on the end, the heeling lead can be held on to with...
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i