Default language
English
GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Menu
0 items
Yukon Advanced Optics 100X Kit
Yukon Advanced Optics 100X Kit
£329.95 inc. tax
£274.96 ex. tax
? Tax based on United Kingdom.

Product Description

The angled, rotating eyepiece allows use when you are unable to align your viewing position with the scope, such as when lying in a prone position.


The kit comprises a 100X Spotting Scope and a 29014 Heavy Duty Tabletop Tripod.

Additionally, get the most from your spotting scope by attaching the Yukon Advanced Optics Spotting Scope Video Attachment, which enables your optical unit to record colour video.
£329.95 inc. tax
£274.96 ex. tax
? Tax based on United Kingdom.
Add to Cart
Product Code: yukonx100
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Details
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i