Default language
English
GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Menu
0 items
Small Dummy Pack
Small Dummy PackSmall Dummy PackSmall Dummy Pack
Small Dummy Pack
£19.99 inc. tax
£16.66 ex. tax
? Tax based on United Kingdom.
Dummy Pack includes
1/2lb canvas dummy
1lb canvas dummy 
1/2lb rabbit dummy
colours may vary
£19.99 inc. tax
£16.66 ex. tax
? Tax based on United Kingdom.
Add to Cart
Product Code: sssdp
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Details
Related Products
1/2lb Duet dummy
dummies/balls/scent
1/2lb Duet dummy
£5.50
Add To Cart
The Sporting Saint 'Duet Dummy' Normal canvas dummy, but with two colours! Top half and bottom half of...
3 piece dummy - large
dummies/balls/scent
3 piece dummy - large
£8.50
Add To Cart
Two sizes Available Small approx 1/2lb weight, Large approx 1lb weight Small ideal puppy/young dog size...
1lb Bird Dummy
dummies/balls/scent
1lb Bird Dummy
£12.50
Add To Cart
Bird Dummy Updated design - now with long throw cord and with the look and feel of a plump bird! Standard...
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i