Default language
English
GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Menu
0 items
Razorback cartridge bag
Razorback cartridge bag
£54.50 inc. tax
£45.42 ex. tax
? Tax based on United Kingdom.
Tough where it counts, the Razorback cartridge bag will hold 120 shotgun shells, strong and practical, scuff panels protect the base and it is waterproof. Extra wide non slip shoulder strap. Ideal companion for the razorback shotgun slip.

£54.50 inc. tax
£45.42 ex. tax
? Tax based on United Kingdom.
Add to Cart
Product Code: 8739T
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Details
Related Products
cartridge pouch
Other Bags
cartridge pouch
£23.15
Add To Cart
Designed to attach to any belt, the deep purse shaped pouch can easily hold 125 12g shells and the smaller...
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i