Default language
English
GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Menu
0 items
Canvas Cartridge Belt
Canvas Cartridge Belt
£32.95 inc. tax
£27.46 ex. tax
? Tax based on United Kingdom.

Our canvas cartridge belt with faux leather cartridge slots, trims and metal buckle is a new take on a classic design. It holds 24 12G cartridges and will fit waist size from 30” to 46”.

£32.95 inc. tax
£27.46 ex. tax
? Tax based on United Kingdom.
Add to Cart
Product Code: jpccb
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Details
Related Products
cartridge pouch
Other Bags
cartridge pouch
£23.15
Add To Cart
Designed to attach to any belt, the deep purse shaped pouch can easily hold 125 12g shells and the smaller...
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i