Default language
English
GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Menu
0 items
Aigle wellington boot bag
Aigle wellington boot bag
£19.50 inc. tax
£16.25 ex. tax
? Tax based on United Kingdom.

The Aigle Rubberbag is the perfect way to store and transport your wellies. Great for keeping your car or hallway clean from muddy boots and an easy way to carry your wellies with you when camping or heading out into the countryside.

FEATURES

    • PVC-coated Oxford fabric
    • Vent mesh
    • Reinforced bottom
    • Contrast double zip
    • Patch pocket at side with Velcro fastening
    • Adjustable strap
    • Reinforced transport handle

    • SPECIFICATIONS

      • Dimensions: L 36cm, H 52cm, D 25cm
      • Exterior: 100% polyester
      • Lining: 100% Polyester
£19.50 inc. tax
£16.25 ex. tax
? Tax based on United Kingdom.
Add to Cart
Product Code: awbb
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Details
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i